PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G039100.1.p
Common NameSb07g003320, SORBIDRAFT_07g003320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 354aa    MW: 38293 Da    PI: 6.2543
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G039100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Sobic.007G039100.1.p 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                          788*******************************************97 PP

2Myb_DNA-binding55.61.2e-1767111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  Sobic.007G039100.1.p  67 RGRFTAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                           89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466898.61E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001674.94E-121761No hitNo description
PROSITE profilePS5129425.93262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.8E-1667111IPR001005SANT/Myb domain
CDDcd001672.04E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPA  120
MSTTSSSVTT ASPPCSTVAS DAALVGHLQT PFSAAAEHQL DAFLSQSLAL PPPKMQVGSG  180
GGQESPPAAP LPPHCPFFMF DTSVSVSPPS SLTSPAAATH QLPHHPFLTF TAAAMDDSPI  240
SYHLPPLVDS MGMAMAAMDC GGLGEESRGH YREAAGNNNG QAAAGMANGG GGCCYGQIKE  300
QEPPALGQDQ WDDESAQHLL MWDDDDQELT PSNLEAMEST AHSLLFMGPN DHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794130.0HF679413.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB7 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443851.10.0hypothetical protein SORBIDRAFT_07g003320
TrEMBLC5YGT50.0C5YGT5_SORBI; Putative uncharacterized protein Sb07g003320
STRINGSb07g003320.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-84myb domain protein 103